PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_AchrUn_randomP09030_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 312aa    MW: 35283.7 Da    PI: 10.1178
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_AchrUn_randomP09030_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-18142196256
                                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                    rk+ +++k+q  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GSMUA_AchrUn_randomP09030_001 142 RKKLRLSKDQAAILEESFKEHNTLNPKQKLALAKRLNLRPRQVEVWFQNRRARTK 196
                                    788899***********************************************98 PP

2HD-ZIP_I/II127.27.1e-41142231191
                    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerL 80 
                                    +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL
  GSMUA_AchrUn_randomP09030_001 142 RKKLRLSKDQAAILEESFKEHNTLNPKQKLALAKRLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRL 221
                                    69****************************************************************************** PP

                    HD-ZIP_I/II  81 ekeveeLreel 91 
                                    +kev+eLr +l
  GSMUA_AchrUn_randomP09030_001 222 QKEVQELR-AL 231
                                    *******9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.0E-1843113IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.605.9E-18130196IPR009057Homeodomain-like
SuperFamilySSF466891.92E-18131199IPR009057Homeodomain-like
PROSITE profilePS5007117.297138198IPR001356Homeobox domain
SMARTSM003896.1E-16140202IPR001356Homeobox domain
CDDcd000862.45E-14142199No hitNo description
PfamPF000464.6E-16142196IPR001356Homeobox domain
PROSITE patternPS000270173196IPR017970Homeobox, conserved site
SMARTSM003404.0E-27198241IPR003106Leucine zipper, homeobox-associated
PfamPF021831.2E-11198232IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MARVAANRPA VSSACSHVPR QGHARPRDGE LPSPFLPREI KPHPRRPTWH ASAQMDRRRD  60
STCRTDPRPR PLHRGIDVNQ EPPGAAERDS EEDAGASSPN STLSSASGKR AERGHHLGVD  120
EHDTDRDCSR GISDEEDGEG SRKKLRLSKD QAAILEESFK EHNTLNPKQK LALAKRLNLR  180
PRQVEVWFQN RRARTKLKQT EVDCEFLKRC CETLTEENRR LQKEVQELRA LKVSPRLYMH  240
MTPPTTLSMC PSCERVSNAA TTTTTAASTP TPETNTPHPM SQHHQFIHHR PFPAPWAPIP  300
LRPCLKTPPQ RS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140146SRKKLRL
2190198RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009386388.11e-168PREDICTED: homeobox-leucine zipper protein HAT4-like isoform X2
SwissprotQ054661e-86HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLM0U7L30.0M0U7L3_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP09030_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.16e-84homeobox protein 2